| Title | Solution NMR Structure of the Brct Domain from Thermus Thermophilus DNA Ligase. To be Published | | Site | NESGC | | PDB Id | | Target Id | WR64Tt | | Molecular Characteristics | | Source | Caenorhabditis elegans | | Alias Ids | TPS9248,PF00533, 5328, 3.40.50.10190 | Molecular Weight | 10013.03 Da. | | Residues | 92 | Isoelectric Point | 9.34 | | Sequence | mekggealkgltfvitgelsrpreevkallrrlgakvtdsvsrktsylvvgenpgsklekaralgvptl teeelyrlleartgkkaeelvgs | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
