.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kkg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Solution NMR Structure of Ribosome-binding Factor A (RbfA), A Cold-shock Adaptation Protein from Escherichia coli. J.Mol.Biol. 327 521-536 2003
    Site NESGC
    PDB Id 1kkg Target Id WR90EC
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9250,5093, 3.30.300.20, PF02033 Molecular Weight 12271.73 Da.
    Residues 108 Isoelectric Point 9.00
    Sequence makefgrpqrvaqemqkeialilqreikdprlgmmttvsgvemsrdlayakvyvtflndkdedavkagi kalqeasgfirsllgkamrlrivpeltffydnslvegmr
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch