| Title | Solution structure of Pyrobaculum aerophilum DsrC, an archaeal homologue of the gamma subunit of dissimilatory sulfite reductase. Eur.J.Biochem. 268 5842-5850 2001 | | Site | NESGC | | PDB Id | | Target Id | OP1 | | Molecular Characteristics | | Source | Other | | Alias Ids | TPS8990,1.10.10.370, 5115, 3.30.1420.10, PF04358 | Molecular Weight | 12668.02 Da. | | Residues | 111 | Isoelectric Point | 5.20 | | Sequence | mpvkcpgeyqvdgkkvildedcfmqnpedwdekvaewlarelegiqkmteehwklvkylreywetfgsc ppikmvtketgfslekiyqlfpsgpahgackvagapkptgcv | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
