| Title | Rapid fold and structure determination of the archaeal translation elongation factor 1beta from Methanobacterium thermoautotrophicum. J.Biomol.NMR 17 187-194 2000 | | Site | NESGC | | PDB Id | | Target Id | TT12 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9195,PF00736, 4385, 3.30.70.60 | Molecular Weight | 9531.33 Da. | | Residues | 89 | Isoelectric Point | 4.17 | | Sequence | mgdvvatikvmpespdvdlealkkeiqeripegtelhkideepiafglvalnvmvvvgdaeggteaaee slsgiegvsnievtdvrrlm | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
