| Title | The crystal structure of MT0146/CbiT suggests that the putative precorrin-8w decarboxylase is a methyltransferase. Structure 10 1475-1487 2002 | | Site | NESGC | | PDB Id | | Target Id | TR1 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9187,PF01209, PF08241, PF09445, PF06325, PF05175, 3.40.50.150, PF03602, PF01170, PF02475, PF01135 | Molecular Weight | 20712.81 Da. | | Residues | 192 | Isoelectric Point | 4.88 | | Sequence | mipddefiknpsvpgptamevrclimclaepgkndvavdvgcgtggvtlelagrvrrvyaidrnpeais ttemnlqrhglgdnvtlmegdapealckipdidiavvggsggelqeilriikdklkpggriivtaille tkfeameclrdlgfdvnitelniargraldrgtmmvsrnpvaliytgvshenkd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 2.40 | Rfree | 0.291 | | Matthews' coefficent | 2.54 | Rfactor | 0.236 | | Waters | 180 | Solvent Content | 51.62 |
| Ligand Information | | Ligands | | | Metals | | | |
