.
The Open Protein Structure Annotation Network
PDB Keyword
.

1f35

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The crystal structure of the olfactory marker protein at 2.3 A resolution. J.Mol.Biol. 319 807-821 2002
    Site NESGC
    PDB Id 1f35 Target Id HC1
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS8904,2.60.120.390, PF06554 Molecular Weight 18865.61 Da.
    Residues 163 Isoelectric Point 5.00
    Sequence maedgpqkqqlemplvldqdltqqmrlrveslkqrgekkqdgeklirpaesvyrldfiqqqklqfdhwn vvldkpgkvtitgtsqnwtpdltnlmtrqlldpaaifwrkedsdamdwneadalefgerlsdlakirkv myflitfgegvepanlkasvvfnql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2470000
    Matthews' coefficent 4.75 Rfactor 0.2100000
    Waters 176 Solvent Content 74.09

    Ligand Information
    Ligands CAC (CACODYLATE) x 1
    Metals ZN (ZINC) x 10

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch