.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ep0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal structure of dTDP-4-keto-6-deoxy-D-hexulose 3,5-epimerase from Methanobacterium thermoautotrophicum complexed with dTDP. J.Biol.Chem. 275 24608-24612 2000
    Site NESGC
    PDB Id 1ep0 Target Id TT3
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus
    Alias Ids TPS9204,2.60.120.10, PF00908 Molecular Weight 21677.26 Da.
    Residues 185 Isoelectric Point 4.56
    Sequence maefrfiktsldgaiiiepevytdergyfmetfneaifqenglevrfvqdnesmsvrgvlrglhfqrek pqgklvrvirgeifdvavdlrknsdtygewtgvrlsdenrreffipegfahgflalsdecivnykctel yhpeydsgipwddpdigidwplemvddliisekdrnwkplrenpvyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.21
    Matthews' coefficent 2.13 Rfactor 0.183
    Waters 126 Solvent Content 42.18

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch