| Title | NMR Structure Determination and Structure-Based Functional Characterization of Conserved Hypothetical Protein MTH1175 from Methanobacterium Thermoautotrophicum. J.STRUCT.FUNCT.GENOM. 1 15-25 2000 | | Site | NESGC | | PDB Id | | Target Id | TP2 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9186,3.30.420.130, 4796, PF02579 | Molecular Weight | 13159.16 Da. | | Residues | 124 | Isoelectric Point | 9.51 | | Sequence | mkiaiassgtdlgsevsrffgrapyfmivemkkgniessevienpsasasggagirtaqiianngvkav iasspgpnafevlnelgikiyratgtsveenlklftegnleeirspgsgrgrrrr | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
