| Title | Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70. J.Biol.Chem. 275 31266-31268 2000 | | Site | NESGC | | PDB Id | | Target Id | YT101 | | Molecular Characteristics | | Source | Saccharomyces cerevisiae | | Alias Ids | TPS9260,1.20.930.10, PF08711, 4726 | Molecular Weight | 12539.73 Da. | | Residues | 111 | Isoelectric Point | 9.33 | | Sequence | mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnveisklvkkmi sswkdainknkrsrqaqqhhqdhapgnaedkttvgesvngvq | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
