| Title | Structural proteomics of an archaeon. Nat.Struct.Biol. 7 903-909 2000 | | Site | NESGC | | PDB Id | | Target Id | TT1 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9192,2.30.110.10, PF01613 | Molecular Weight | 20873.57 Da. | | Residues | 192 | Isoelectric Point | 5.21 | | Sequence | gsqaahmmsmdfedfpvesahriltprptvmvttvdeegninaapfsftmpvsidppvvafasapdhht arniesthefvinitpadiiermwvtardipageneleaaglawtssrrvkppriveapghlecellrm fevgdhnlitgsvvsasvrsgavkeglldvesvkpvlhvggnkfvvgdhvrhve | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.20 | Rfree | 0.2790000 | | Matthews' coefficent | 2.43 | Rfactor | 0.2250000 | | Waters | 65 | Solvent Content | 49.40 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1;FMN (FLAVIN) x 1 | | Metals | NI (NICKEL) x 2 | | |
Protein Summary
This protein shares sequence similarity with
375043 which has more annotation.
Ligand Summary
