| Title | Solution structure of the RNA polymerase subunit RPB5 from Methanobacterium thermoautotrophicum. Proc.Natl.Acad.Sci.USA 97 6311-6315 2000 | | Site | NESGC | | PDB Id | | Target Id | TT9 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | TPS9216,PF01191, 4678, 3.90.940.20 | Molecular Weight | 8807.88 Da. | | Residues | 77 | Isoelectric Point | 9.35 | | Sequence | mkreilkhqlvpehvilneseakrvlkeldahpeqlpkikttdpvakaigakrgdivkiirksptaeef vtyrlvqd | | | BLAST FFAS | | Structure Determination | | Method | NMR | Chains | 1 |
| Ligand Information | | Ligands | | | Metals | | | |
