| Title | Zinc-bundle structure of the essential RNA polymerase subunit RPB10 from Methanobacterium thermoautotrophicum. Proc.Natl.Acad.Sci.USA 97 6316-6321 2000 | | Site | NESGC | | PDB Id | 1ef4 | Target Id | TT11 | | Molecular Characteristics | | Source | Methanothermobacter thermautotrophicus | | Alias Ids | 1.10.10.60, 4571, | Molecular Weight | 6434.13 Da. | | Residues | 55 | Isoelectric Point | 7.66 | | Sequence | mipvrclscgkpvsayfneyqrrvadgedpkdvlddlglkryccrrmlishvetw | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | ZN (ZINC) x 1 | | |
