.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC7242

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC7242
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5098, Molecular Weight 40254.64 Da.
    Residues 367 Isoelectric Point 7.01
    Sequence mdrrsfirkagavgagvtatalaapaiaqenpkitwrmtssftkgldilfgagqivadhvkeasggnfviqhfagg eivpalqaadavtagtvemahtcsyyyvgkdptfalgtsvpfglnarqtnawfnqaggnellneflaqhniysil lgntgaqmggwfrkeintiddlkglkmriagltgqvmqkvgvtpqqiaggdvyaalekgtidatefvgpyddqkl gfykvakyyyypawweggpavhafvnlqkfndlpenykrilkdacaagsasmlerydarnpkalkelvaqgailr pfsqeildvchkaaqdtyaeisaknesfkkiyesqqafkkdaylwaqiaeytydtymmiqqrngtl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch