.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC6240

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Diffraction
    Target Id APC6240
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5049, Molecular Weight 20934.77 Da.
    Residues 194 Isoelectric Point 6.60
    Sequence mgpqekprrvrmtpgarrvlaaaerlfyehgihavgvdtiaaeagvtkktlydrfgskeqivveylagrderwrel lagrlaaagegpaarvvavfeasrawselygakgcsminahaeisdpghpaypvitgqkrwmldlftglardida agadrlartlvllhegalvshgvgvlpdpfgaaldqvrelldg
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch