The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC5834
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4867, Molecular Weight 23133.08 Da.
    Residues 214 Isoelectric Point 5.11
    Sequence mvksvlcfgdsltwgsnaetggrhshddlwpsvlqkalgsdvhviheglggrttayddhtgdcdrngarllptllh shapldmviimlgtndmkpaihgsaivamkgverlvkltrnhvwqvsdweapdvlivappqlcetanpfmgaifr daidesamlasvyrdladeldcgffdagsvarttpvdgvhldaentraigrglepvvrmmlgl
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch