.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC5732

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC5732
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4789, Molecular Weight 21630.23 Da.
    Residues 179 Isoelectric Point 9.34
    Sequence mprelgeslelrkgrhsvvyltekyaikqfherfrynflkevkfltllqpffftpklyfvdfanlrivmerlrgrr fdeafirkaveraleacfimdvmgvekqemnhpdkhiivgddvylidferarfkdrpsnltqfcmylrrfgieie ktllkdyktsvncenfsrilhsvveklk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch