.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4714

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC4714
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4623,AAD36456, 2336 TM1386 Molecular Weight 8036.68 Da.
    Residues 69 Isoelectric Point 4.55
    Sequence mregekvffieggplgeegtyiivsddptveeriakvieelnttsviflaedeyerfknelekkakriw
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch