.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC1331

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC1331
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4531, Molecular Weight 47509.79 Da.
    Residues 429 Isoelectric Point 4.92
    Sequence mrlkkigewlnaspedqdkqnadllqtlskltgkqldanalqmlqnllqavesknvsgtdqlltetekifseakta lsandsasdingalksdkeqsnqenevsepakeliyiqmfisqlvegnkltdlgngneahaiyqngdqflsalek kgvsqqliqdlkqqiftkaesssklysmtaselksfqslmdqmsmlpqkgtkewslaetqlkafllskssessqd fgksvltplsqssssknasdvsgsiqpvdsksglqmlfsgyrgiggvqtldlqqmssdipnaetktvadqvinaw kqmkytpfgrstgsftirlnpehlgfvtikltnengmfqskiiassqsakelleqhlpqlkqslpnmavqidrft lpvqsgdqpiygqladeqkqqqegqrqqrqkkqsndfgdlldevsmvemeeee
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch