.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC1292

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Diffraction
    Target Id APC1292
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4528, Molecular Weight 33570.69 Da.
    Residues 303 Isoelectric Point 6.14
    Sequence mkflvvgaggvggyiggrlsekgndvtflvrqkraeqlkktglvihsekgnvsfqpelisagetgqfdvviiaska yslgqviedvkpfihqesviipflngyrhyeqlfaafskeqvlgglcfiesaldnkgeihhtsashrfvfgewng erteriraleeafsgvkaeviisghiekdiwkkylfiaaqagittlfqrplgpilateagrhtaqtligeictvl rkegvpadpaleeesfrtmtsmsyhmkssmlrdmengqttegdhlhgfliekakrlslaapvletvyanlqmyea ek
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch