The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YaeB-like protein from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3okx Target Id APC5921
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS4930,NP_945505.1, 258594 Molecular Weight 18610.05 Da.
    Residues 167 Isoelectric Point 5.92
    Sequence mdatddiragelasdwsgspdagvvfigrihtpwnrlkecprhgradgpvcrievfetwlpalagiddg tllevfywlhrsrrdlllqcprndgdargtfsirsplrpnpigtsiarvdrrdganlfirgldcldgtp lvdlkpdraefmplappkpgdfqvgeprr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.1819
    Matthews' coefficent 2.46 Rfactor 0.1469
    Waters 286 Solvent Content 50.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch