.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m2o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative glyoxalase/bleomycin resistance protein from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 3m2o Target Id APC6230
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5044,NP_946255.1, 258594 Molecular Weight 15563.59 Da.
    Residues 143 Isoelectric Point 4.65
    Sequence mrstsyypvimtsdvaataafycqhfgfrplfeadwyvhlqsaedpavnlaildgqhstipaagrgqvs glilnfevddpdreyarlqqaglpilltlrdedfgqrhfitadpngvlidiikpippsanyaaqyagga aaaqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.35 Rfree 0.19425
    Matthews' coefficent Rfactor 0.16537
    Waters 269 Solvent Content

    Ligand Information
    Ligands NH4 (AMMONIUM) x 28;PG4 (TETRAETHYLENE) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch