The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Protein Af1124 from Archaeoglobus Fulgidus. To be Published
    Site MCSG
    PDB Id 3k67 Target Id APC5830
    Related PDB Ids 2b3m 
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4865,AAB90117, 224325 Molecular Weight 17605.65 Da.
    Residues 159 Isoelectric Point 7.72
    Sequence mgggevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdlnpvhfd edfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvrvegvvsgveknryti dvkcytgdkvvaegvvkvliw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.16559
    Matthews' coefficent 2.40 Rfactor 0.14569
    Waters 364 Solvent Content 49.10

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    No description
    21 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch