.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iuv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a member of TetR family (SCO1917) from Streptomyces coelicolor A3. To be Published
    Site MCSG
    PDB Id 3iuv Target Id APC6223
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5040,NP_626183.1, 100226 Molecular Weight 21067.67 Da.
    Residues 197 Isoelectric Point 5.39
    Sequence mprrhdperrqriidaairvvgqkgiaglshrtvaaeadvplgsttyhfatlddlmvaalrqanegfar vvaahpalsdpeadlsgelarvlgewlggdrtgveleyelylaalrrpalrpvaaewaegvgallaart dpttaralvavldgiclqvlltdtpydeeyarevltrlipvpatrdgrgpgshppatag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.2882
    Matthews' coefficent 2.51 Rfactor 0.2407
    Waters Solvent Content 51.05

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch