.
The Open Protein Structure Annotation Network
PDB Keyword
.

3him

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a Bacterial Regulatory Protein in the tetR Family from Rhodococcus RHA1 to 2.2A. To be Published
    Site MCSG
    PDB Id 3him Target Id APC6038
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4984,RHA04224, 101510 Molecular Weight 22649.33 Da.
    Residues 211 Isoelectric Point 6.37
    Sequence mdasltgavaelgtskaaariraaaievfaakgygatttreiaasldmspgavyphyktkesllyaisl eghhsvlaaitaadfpdiaapdrlmstvtayvtwhadnrasarvgqyelrslspehfaiiadirrsttk vftriieagatagdfhpfdieaaalaitslgidvsrwfpshtysdpriiaaryvelalrmvgcadrqpl dkps
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.248
    Matthews' coefficent 2.05 Rfactor 0.197
    Waters 132 Solvent Content 39.90

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3him
    1. Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
    Y Agari, K Sakamoto, S Kuramitsu - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch