.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fhm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the CBS-domain containing protein ATU1752 from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3fhm Target Id APC7156
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5091,NP_532435.1, 176299 Molecular Weight 15143.56 Da.
    Residues 144 Isoelectric Point 5.92
    Sequence matfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgifterdlvkavagqgaas lqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrlagiisigdvvkarigeieaeaehi kayiag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.26164
    Matthews' coefficent 2.19 Rfactor 0.19536
    Waters 47 Solvent Content 43.87

    Ligand Information
    Ligands AMP (ADENOSINE) x 4;NAI (1,4-DIHYDRONICOTINAMIDE) x 4;SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3fhm
    1. Binding of S-methyl-5'-thioadenosine and S-adenosyl-L-methionine to protein MJ0100 triggers an open-to-closed conformational change in its CBS motif pair
    M Lucas, JA Encinar, EA Arribas, I Oyenarte - Journal of molecular , 2010 - Elsevier
     
    2. The CBS Domain: A Protein Module with an Emerging Prominent Role in Regulation
    AA Baykov, HK Tuominen, R Lahti - ACS Chemical Biology, 2011 - ACS Publications
     
    3. Purification, crystallization and preliminary crystallographic analysis of protein MJ1225 from Methanocaldococcus jannaschii, a putative archaeal homologue of-AMPK
    I Gomez Garcia, D Kortzar, I Oyenarte - Section F: Structural , 2009 - scripts.iucr.org
     
    4. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch