.
The Open Protein Structure Annotation Network
PDB Keyword
.

3f6v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Possible transcriptional regulator for arsenical resistance from Rhodococcus sp. To be Published
    Site MCSG
    PDB Id 3f6v Target Id APC7198
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5093,RHA06349, 101510 Molecular Weight 14404.47 Da.
    Residues 129 Isoelectric Point 6.84
    Sequence mnsptsrplrrdplhnalvttnvlvvldqlevaaeptrrrlvqlltsgeqtvnnlaahfpasrsaisqh lrvlteaglvtprkdgrfryyrldpqglaqlralfdsfwideldrlvadateeaaskgds
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.48 Rfree 0.19929
    Matthews' coefficent Rfactor 0.15943
    Waters 130 Solvent Content

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3f6v
    1. Purification, crystallization and preliminary X-ray diffraction studies of the arsenic repressor ArsR from Corynebacterium glutamicum
    S Santha, EPJ Pandaranayaka, BP Rosen - Section F: Structural , 2011 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch