.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dm8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Isomerase from Rhodopseudomonas palustris. To be Published
    Site MCSG
    PDB Id 3dm8 Target Id APC6271
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5056,NP_949684.1, 258594 Molecular Weight 16338.94 Da.
    Residues 143 Isoelectric Point 8.97
    Sequence mtehslwrfsralhralndrqteelatiiddnidwaiygpidmfpffgarqgkaavlevcrqiadsvri yryhresvmlgidsaasmvrysltaagtnrpisvrmalftqfqngrltnlrmvldtfdlveqalgrpih lpkia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.216
    Matthews' coefficent 2.53 Rfactor 0.178
    Waters 174 Solvent Content 51.46

    Ligand Information
    Ligands CE9 (DODECYL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3dm8
    1. The protein meta-structure: a novel concept for chemical and molecular biology
    R Konrat - Cellular and molecular life sciences, 2009 - Springer
     
    2. Fold space unlimited
    MJ Sippl - Current opinion in structural biology, 2009 - Elsevier
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch