.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dca

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the RPA0582- protein of unknown function from Rhodopseudomonas palustris- a structural genomics target. To be Published
    Site MCSG
    PDB Id 3dca Target Id APC6229
    Related PDB Ids 3hhl 
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5043,NP_945935.1, 258594 Molecular Weight 16057.49 Da.
    Residues 142 Isoelectric Point 6.52
    Sequence mtghidptkevfaqfrandregpihmlnlvrlrpraaypdgrettgaeayaaygrdsgpvferlggkvv wqgqfelmligpqdehwdhvfiaeypsvaafvemirdpvyreavkhrqaavedsrlirlkplkpgkgfg eipt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 3.35 Rfree 0.29
    Matthews' coefficent Rfactor 0.273
    Waters Solvent Content

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 3dca
    1. Approaches and resources for prediction of the effects of non-synonymous single nucleotide polymorphism on protein function and interactions
    S Teng, E Michonova-Alexova - Current pharmaceutical , 2008 - ingentaconnect.com
     
    2. Rapid measurement of residual dipolar couplings for fast fold elucidation of proteins
    RM Rasia, E Lescop, JF Palatnik, J Boisbouvier - Journal of biomolecular , 2011 - Springer
     
    3. A holistic in silico approach to predict functional sites in protein structures
    J Segura, PF Jones, N Fernandez-Fuentes - Bioinformatics, 2012 - Oxford Univ Press
     
    4. Functional Non-Synonymous Polymorphisms Prediction Methods: Current Approaches and Future Developments
    M Gonzalez-Castejon, F Marin - Current medicinal , 2011 - ingentaconnect.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch