.
The Open Protein Structure Annotation Network
PDB Keyword
.

3czp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Polyphosphate-dependent synthesis of ATP and ADP by the family-2 polyphosphate kinases in bacteria. Proc.Natl.Acad.Sci.USA 105 17730-17735 2008
    Site MCSG
    PDB Id 3czp Target Id APC6077
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4997,NP_252145.1, 208964 Molecular Weight 58328.43 Da.
    Residues 496 Isoelectric Point 8.21
    Sequence mfesaevghsidkdtyekavielrealleaqfelkqqarfpviilingiegagkgetvkllnewmdprl ievqsflrpsdeelerppqwrfwrrlppkgrtgiffgnwysqmlyarveghikeakldqaidaaerfer mlcdegallfkfwfhlskkqlkerlkalekdpqhswklspldwkqsevydrfvhygervlrrtsrdyap wyvvegaderyraltvgrilleglqaalatkerakrqphaaplvssldnrglldsldlgqyldkdayke qlaaeqarlaglirdkrfrqhslvavfegndaagkggairrvtdaldprqyhivpiaapteeeraqpyl wrfwrhiparrqftifdrswygrvlveriegfcapadwlraygeindfeeqlseygiivvkfwlaidkq tqmerfkerektpykrykiteedwrnrdkwdqyvdavgdmvdrtsteiapwtlveandkrfarvkvlrt indaieaaykkdk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2306
    Matthews' coefficent 2.49 Rfactor 0.17349
    Waters 668 Solvent Content 50.56

    Ligand Information
    Ligands GOL (GLYCEROL) x 4;ACT (ACETATE) x 5;EDO (1,2-ETHANEDIOL) x 3;MLI (MALONATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3czp
    1. Polyphosphate-dependent synthesis of ATP and ADP by the family-2 polyphosphate kinases in bacteria
    B Nocek, S Kochinyan, M Proudfoot - Proceedings of the , 2008 - National Acad Sciences
     
    2. Polyphosphate-an ancient energy source and active metabolic regulator
    L Achbergerov, J Nahlka - nature, 2011 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch