.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cuo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the predicted DNA-binding transcriptional regulator from E. coli. To be Published
    Site MCSG
    PDB Id 3cuo Target Id APC5993
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4967,AAC75714.1, 83333 Molecular Weight 10595.63 Da.
    Residues 99 Isoelectric Point 8.74
    Sequence mtelaqlqasaeqaaallkamshpkrllilcmlsgspgtsageltritglsasatsqhlarmrdeglid sqrdaqrilysikneavnaiiatlknvycp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.28875
    Matthews' coefficent 2.06 Rfactor 0.2274
    Waters 48 Solvent Content 40.28

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3cuo
    1. Plant Pathogenic Bacteria Utilize Biofilm Growth-associated Repressor (BigR), a Novel Winged-helix Redox Switch, to Control Hydrogen Sulfide Detoxification under
    BG Guimares, RL Barbosa, AS Soprano - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch