.
The Open Protein Structure Annotation Network
PDB Keyword
.

3cum

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 3cum Target Id APC6014
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4979,NP_249434.1, 208964 Molecular Weight 30752.56 Da.
    Residues 298 Isoelectric Point 5.38
    Sequence mkqiafiglghmgapmatnllkagyllnvfdlvqsavdglvaagasaarsardavqgadvvismlpasq hveglyldddgllahiapgtlvlecstiaptsarkihaaarerglamldapvsggtagaaagtltfmvg gdaealekarplfeamgrnifhagpdgagqvakvcnnqllavlmigtaeamalgvangleakvlaeimr rssggnwalevynpwpgvmenapasrdysggfmaqlmakdlglaqeaaqasasstpmgslalslyrlll kqgyaerdfsvvqklfdptqgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.239
    Matthews' coefficent 2.43 Rfactor 0.18969
    Waters 80 Solvent Content 49.43

    Ligand Information
    Ligands ACT (ACETATE) x 3;EDO (1,2-ETHANEDIOL) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch