.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c2b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of TetR transcriptional regulator from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3c2b Target Id APC5923
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4932,NP_532696.1, 176299 Molecular Weight 23793.69 Da.
    Residues 217 Isoelectric Point 7.86
    Sequence masdpittqefsprqnavldqalrllveggekalttsglaraancskeslykwfgdrdgllaamitfqq skvrtfekagdrvsapqladhlevfahdlldvlagdvslalnrlaigqasrdgsklgdlllergrrqid rrarglieagrrsgylrfddaeeayrsfyglivsdlhvrmllgeapdkdfsarakkavvafltlygtek vhselggkva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2406
    Matthews' coefficent 2.10 Rfactor 0.1984
    Waters 92 Solvent Content 41.46

    Ligand Information
    Ligands FMT (FORMIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch