.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a TetR family transcriptional regulator from Streptomyces coelicolor A3(2). To be Published
    Site MCSG
    PDB Id 3c07 Target Id APC6322
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5076,NP_629005.1, 100226 Molecular Weight 28272.79 Da.
    Residues 251 Isoelectric Point 6.68
    Sequence mpatndgpddgahlskseqtraliletamrlfqergydrttmraiaqeagvsvgnayyyfagkehliqg fydriaaehraavrevlaretdlearlagvlkvwldiatpyhefavqffknaadpdsplspfspeseha rveaigihravlagaktkvpeelrdilpelmwlsqmglvlywifdrtegrersyrlaergarltargvv larfrvlrplvrevhelftdflpgmtkvmpdpakkptrdagpqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.28894
    Matthews' coefficent 2.34 Rfactor 0.21772
    Waters Solvent Content 47.36

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 3c07
    1. A Nonsense Mutation in COQ9 Causes Autosomal-Recessive Neonatal-Onset Primary Coenzyme Q 10 Deficiency: A Potentially Treatable Form
    AJ Duncan, M Bitner-Glindzicz, B Meunier - The American Journal of , 2009 - Elsevier
     
    2. Complementation and Reconstitution of Fluorescence from Circularly Permuted and Truncated Green Fluorescent Protein
    Y Huang, C Bystroff - Biochemistry, 2009 - ACS Publications
     
    3. Constraining local structure can speed up folding by promoting structural polarization of the folding pathway
    PM Buck, C Bystroff - Protein Science, 2011 - Wiley Online Library
     
    4. Simulating protein folding initiation sites using an alpha_carbon_only knowledge_based force field
    PM Buck, C Bystroff - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     
    5. Webservice und Workflow-Technologie fr Proteinmodellierung
    FBD Wagner - 2010 - elib.uni-stuttgart.de
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch