.
The Open Protein Structure Annotation Network
PDB Keyword
.

3brq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the E. coli transcriptional repressor ascG. To be Published
    Site MCSG
    PDB Id 3brq Target Id APC5946
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4951,AAC75756.1, 83333 Molecular Weight 32255.16 Da.
    Residues 294 Isoelectric Point 6.00
    Sequence sgyrpnllarnlsakstqtlglvvtntlyhgiyfsellfhaarmaeekgrqllladgkhsaeeerqaiq ylldlrcdaimiyprflsvdeiddiidahsqpimvlnrrlrknsshsvwcdhkqtsfnavaelinaghq eiafltgsmdsptsierlagykdalaqhgialnekliangkwtpasgaegvemllergakfsalvasnd dmaigamkalhergvavpeqvsvigfddiaiapytvpalssvkipvtemiqeiigrlifmldggdfspp ktfsgklirrdsliapsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.24912
    Matthews' coefficent 2.02 Rfactor 0.1856
    Waters 351 Solvent Content 39.16

    Ligand Information
    Ligands FRU (FRUCTOSE) x 1;SO4 (SULFATE) x 2
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch