.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bqw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title The crystal structure of the putative capsid protein of prophage (E.coli CFT073). To be Published
    Site MCSG
    PDB Id 3bqw Target Id APC88028
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS5901,AAN79968.1, PF03864, 199310 Molecular Weight 39630.18 Da.
    Residues 351 Isoelectric Point 5.28
    Sequence mtvkamalntnqlfaylnrgdiaefkfsplfttlffpnvatfstqnimldtldieevtmsafcspmvgs qvqrdkgyetstikpgymkpkheidptktimrmagedpaqlndptyrrmrlitgnmrrqinaikarvew lavnavttgkniiegegieryeidwkipekniieqadgkkwseqdkethypiydielyadqagcpanvm imgaevwrtlrsfkkfrelydlsrgsesaaelacknlgevvsfkgylgdlalivysgkytdsdgtekyf lepdllvlgntnnkglvaygaimdqeavrtgatqnmfypknwiedgdpaieyvqthsapqpvpadirkf vtvkia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2251
    Matthews' coefficent 2.76 Rfactor 0.1748
    Waters 286 Solvent Content 55.51

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch