.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rc3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of CBS domain, NE2398. To be Published
    Site MCSG
    PDB Id 2rc3 Target Id APC6198
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5029,NP_842393.1, 228410 Molecular Weight 16584.43 Da.
    Residues 146 Isoelectric Point 5.78
    Sequence mktvkhllqekghtvvaigpddsvfnamqkmaadnigallvmkdeklvgilterdfsrksylldkpvkd tqvkeimtrqvayvdlnntnedcmalitemrvrhlpvlddgkvigllsigdlvkdaisqhqfvinqler yiydtrei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.23595
    Matthews' coefficent 2.09 Rfactor 0.18759
    Waters 710 Solvent Content 41.30

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4
    Metals BR (BROMIDE) x 39

    Jmol

     
    Google Scholar output for 2rc3
    1. Binding of S-methyl-5'-thioadenosine and S-adenosyl-L-methionine to protein MJ0100 triggers an open-to-closed conformational change in its CBS motif pair
    M Lucas, JA Encinar, EA Arribas, I Oyenarte - Journal of molecular , 2010 - Elsevier
     
    2. Prediction of thioredoxin and glutaredoxin target proteins by identifying reversibly oxidized cysteinyl residues.
    HM Lee, KJ Dietz, R Hofestdt - J Integrat Bioinform, 2010 - imbio.de
     
    3. THE STruCTurAL BASiS For iNorGANiC PyroPHoSPHATASE CATALySiS AND rEGuLATioN
    H Tuominen - 2011 - doria.fi
     
    4. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary

    Please see 1vr9 entry.

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch