The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative ribokinase from Agrobacterium tumefaciens. TO BE PUBLISHED
    Site MCSG
    PDB Id 2rbc Target Id APC6153
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5022,NP_533180.1, 176299 Molecular Weight 34096.08 Da.
    Residues 319 Isoelectric Point 5.10
    Sequence mvkepggkhvlcvgaavldtlfrvadmpkgegkvlpyevlqiaegmassaayavhrmggraslwgavgd detgtrilrdlsesgidtsgmtvapgarsalstiiidnrgerlivpfydhrlhekkractpedialfda vlvdvrwpelaldvltvaralgkpaildgdvapvetleglapaathivfsepaatrltgletvkdmlpv lharypqtfiavtagpagcwwteaddptvhfqttmqveavdtlaagdifhgtfalamaegmqsraavrl ssvaaalkctvfggrigaptreeteeamrqwleresepalras
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.228
    Matthews' coefficent 3.07 Rfactor 0.188
    Waters 400 Solvent Content 59.94

    Ligand Information
    Ligands SO4 (SULFATE) x 5;EDO (1,2-ETHANEDIOL) x 5;GOL (GLYCEROL) x 1
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch