The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2r9q Target Id APC6328
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5078,NP_531138.1, 176299 Molecular Weight 40521.95 Da.
    Residues 370 Isoelectric Point 6.02
    Sequence mtrttgtrttgiladgairalfagdklkseadldvdqvqpasldlrlgskayrvrasfmpgpgtrvidk lnrfslhevdlsqgavletgcvyivplmeslalpadmsasanpksstgrldiftrvmtdnaqefdkipa gytgplyleisprtfpivvrrgsrlsqirfrighallnesevlklhetetlvasenpnvtgggialsid lkgfgengligyrgkhhtavvdvdkkaqhdvldfweplfargraelildpdefyilvsreavhvpplya aemtpfdplvgefrvhyagffdpgfghaqaggtgsravlevrshevpfilehgqivgrlvyehmlekpe glygtglgsnyqaqglklskhfrae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.26949
    Matthews' coefficent 2.29 Rfactor 0.18904
    Waters 622 Solvent Content 46.23

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch