.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r6u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product RHA04853 from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 2r6u Target Id APC7282
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5108,RHA04853, 101510 Molecular Weight 13530.41 Da.
    Residues 125 Isoelectric Point 4.28
    Sequence mtgrivhfeipfddgdrarafyrdafgwaiaeipdmdysmvttgpvgesgmpdepgyinggmmqrgevt tpvvtvdvesiesalerieslggktvtgrtpvgnmgfaayftdsegnvvglwetar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.21076
    Matthews' coefficent 2.09 Rfactor 0.17614
    Waters 667 Solvent Content 41.05

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch