.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r6o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative diguanylate cyclase/phosphodiesterase. To be Published
    Site MCSG
    PDB Id 2r6o Target Id APC7542
    Related PDB Ids 3n3t 
    Molecular Characteristics
    Source Thiobacillus denitrificans atcc 25259
    Alias Ids TPS4795,YP_315023.1, 292415 Molecular Weight 29990.41 Da.
    Residues 272 Isoelectric Point 5.14
    Sequence erltldtrlrqalernelvlhyqpivelasgrivggealvrwedperglvmpsafipaaedtglivals dwvleacctqlrawqqqgraaddltlsvnistrqfegehltravdralarsglrpdcleleitenvmlv mtdevrtcldalrargvrlalddfgtgysslsylsqlpfhglkidqsfvrkipahpsetqivttilala rglgmevvaegietaqqyaflrdrgcefgqgnlmstpqaadafaslldrqkasgqrpvhghetap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21756
    Matthews' coefficent 2.08 Rfactor 0.18829
    Waters 378 Solvent Content 40.93

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3;MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 2r6o
    1. Structure and mechanism of a bacterial light-regulated cyclic nucleotide phosphodiesterase
    TRM Barends, E Hartmann, JJ Griese, T Beitlich - Nature, 2009 - nature.com
     
    2. Catalytic mechanism of cyclic di-GMP-specific phosphodiesterase: a study of the EAL domain-containing RocR from Pseudomonas aeruginosa
    F Rao, Y Yang, Y Qi, ZX Liang - Journal of bacteriology, 2008 - Am Soc Microbiol
     
    3. Structural analysis of the GGDEF-EAL domain-containing c-di-GMP receptor FimX
    MVAS Navarro, N De, N Bae, Q Wang, H Sondermann - Structure, 2009 - Elsevier
     
    4. Crystal structures of YkuI and its complex with second messenger cyclic Di-GMP suggest catalytic mechanism of phosphodiester bond cleavage by EAL domains
    G Minasov, S Padavattan, L Shuvalova - Journal of Biological , 2009 - ASBMB
     
    5. Structural insight into the mechanism of c-di-GMP hydrolysis by EAL domain phosphodiesterases
    A Tchigvintsev, X Xu, A Singer, C Chang - Journal of molecular , 2010 - Elsevier
     
    6. Expression, purification and preliminary crystallographic analysis of Pseudomonas aeruginosa RocR protein
    M Kotaka, S Dutta, HC Lee, MJM Lim - Section F: Structural , 2009 - scripts.iucr.org
     
    7. Identification, activity and disulfide connectivity of C-di-GMP regulating proteins in Mycobacterium tuberculosis
    K Gupta, P Kumar, D Chatterji - PloS one, 2010 - dx.plos.org
     
    8. Second Messenger c-di-GMP Signaling in Pseudomonas aeruginosa
    M Merighi, S Lory - Pseudomonas, 2010 - Springer
     
    9. Synthesis and Characterization of a Fluorescent Analogue of Cyclic-di-GMP
    IM Sharma, T Dhanaraman, R Mathew, D Chatterji - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch