.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r48

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the fructose specific IIB subunit of PTS system from Bacillus subtilis subsp. subtilis str. 168. To be Published
    Site MCSG
    PDB Id 2r48 Target Id APC1979.1
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS4579,CAB13058.1, BIG_517.1, 224308 Molecular Weight 11142.20 Da.
    Residues 103 Isoelectric Point 5.85
    Sequence kllaitscpngiahtymaaenlqkaadrlgvsikvetqggigvenklteeeireadaiiiaadrsvnkd rfigkkllsvgvqdgirkpeeliqkalngdipvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.23743
    Matthews' coefficent 1.78 Rfactor 0.18328
    Waters 57 Solvent Content 30.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r48
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch