.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qsi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative hydrogenase expression/formation protein hupG from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 2qsi Target Id APC6337
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5080,NP_946319.1, 258594 Molecular Weight 13972.22 Da.
    Residues 133 Isoelectric Point 4.57
    Sequence msgslaraaarpnaptlvdeatvddfiahsgkivvlffrgdavrfpeaadlavvlpelinafpgrlvaa evaaeaerglmarfgvavcpslavvqpertlgviakiqdwssylaqigamlaevdqpgeaelqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.20133
    Matthews' coefficent 1.90 Rfactor 0.15194
    Waters 233 Solvent Content 35.23

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qsi
    1. Ni (II) coordination to mixed sites modulates DNA binding of HpNikR via a long-range effect
    AL West, SE Evans, JM Gonzlez - Proceedings of the , 2012 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch