.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qnt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein of unknown function from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 2qnt Target Id APC5895
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4908,NP_532552.1, 176299 Molecular Weight 14764.73 Da.
    Residues 127 Isoelectric Point 5.19
    Sequence mrfvnpipfvrdinrsksfyrdrlglkiledfgsfvlfetgfaihegrsleetiwrtssdaqeaygrrn mllyfehadvdaafqdiaphvelihplerqawgqrvfrfydpdghaievgeslsqsge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.19907
    Matthews' coefficent 2.02 Rfactor 0.16873
    Waters 154 Solvent Content 39.12

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch