.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qib

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of tetR-family transcriptional regulator from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 2qib Target Id APC6280
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5059,NP_626474.1, 100226 Molecular Weight 25373.45 Da.
    Residues 230 Isoelectric Point 5.20
    Sequence mttgvrrrmgveerrqqligvaldlfsrrspdevsideiasaagisrplvyhyfpgklslyeaalqras ddladrfveprqgplgarllrvmgryfdfvdehgpgfsalmrggpavgstttnalvdsvrqaayvqils hldvtepparlelvvrswislaestallwldgrripraeletqlvhdfaalmavsaaydeemgalvrrv ladepedgpfgdlvdrllalsar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.21412
    Matthews' coefficent 2.52 Rfactor 0.17733
    Waters 619 Solvent Content 51.12

    Ligand Information
    Ligands P6G (HEXAETHYLENE) x 4
    Metals

    Jmol

     
    Google Scholar output for 2qib
    1. A Nonsense Mutation in COQ9 Causes Autosomal-Recessive Neonatal-Onset Primary Coenzyme Q 10 Deficiency: A Potentially Treatable Form
    AJ Duncan, M Bitner-Glindzicz, B Meunier - The American Journal of , 2009 - Elsevier
     
    2. Structural basis for the transcriptional regulation of heme homeostasis in Lactococcus lactis
    H Sawai, M Yamanaka, H Sugimoto, Y Shiro - Journal of Biological , 2012 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch