.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qh1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Biochemical and structural characterization of a novel family of cystathionine beta-synthase domain proteins fused to a Zn ribbon-like domain. J.Mol.Biol. 375 301-315 2008
    Site MCSG
    PDB Id 2qh1 Target Id APC5508
    Related PDB Ids 1pvm 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4670,NP_393769, 2303 Molecular Weight 20283.36 Da.
    Residues 178 Isoelectric Point 8.22
    Sequence mfmrvekimnsnfktvnwnttvfdavkimnenhlyglvvkddngndvgllsersiikrfiprnkkpdev pirlvmrkpipkvksdydvkdvaaylsenglercavvddsgrvvgivtltdlsrylsrasitdillshr tkdyqhlcpkcgvgvlepvynekgeikvfrcsnpacdyee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.237
    Matthews' coefficent 2.01 Rfactor 0.202
    Waters 345 Solvent Content 38.81

    Ligand Information
    Ligands
    Metals FE2 (FE) x 2

    Jmol

     
    Google Scholar output for 2qh1
    1. Biochemical and Structural Characterization of a Novel Family of Cystathionine [beta]-Synthase Domain Proteins Fused to a Zn Ribbon-Like Domain
    M Proudfoot, SA Sanders, A Singer, R Zhang - Journal of molecular , 2008 - Elsevier
     
    2. Binding of S-methyl-5'-thioadenosine and S-adenosyl-L-methionine to protein MJ0100 triggers an open-to-closed conformational change in its CBS motif pair
    M Lucas, JA Encinar, EA Arribas, I Oyenarte - Journal of molecular , 2010 - Elsevier
     
    3. Functional studies on bacterial nucleotide-regulated inorganic pyrophosphatases
    J Jmsn - 2011 - doria.fi
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1pvm.png
    No description
    30.43 kB22:13, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch