.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q24

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TetR transcriptional regulator SCO0520 from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 2q24 Target Id APC6213
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5036,NP_624834.1, 100226 Molecular Weight 20841.35 Da.
    Residues 194 Isoelectric Point 6.62
    Sequence msdatkrplradaqrnrdkilaaavrvfseegldahleriareagvgsgtlyrnfptrealieaayrne varlcdsvpgllaelppaealrawtrrfidyataklgmadalravvasggdpygdsrqliqsaltalmd aaaaageirsdirstdmfaalagialtssrpdqraqaerlldlvldglrptaprpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.225
    Matthews' coefficent 2.17 Rfactor 0.191
    Waters 273 Solvent Content 43.32

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 2q24
    1. A new Italian FHM2 family: Clinical aspects and functional analysis of the disease-associated mutation
    L Santoro, F Manganelli, MR Fortunato - , 2011 - cep.sagepub.com
     
    2. Molecular genetic studies of gene identification for osteoporosis
    Y Guo, TL Yang, F Pan, XH Xu - Expert Review of , 2008 - ingentaconnect.com
     
    3. ATM gene alterations in chronic lymphocytic leukemia patients induce a distinct gene expression profile and predict disease progression
    A Guarini, M Marinelli, S Tavolaro, E Bellacchio - , 2011 - haematologica.com
     
    4. Membrane transporters and drug development: relevance to pharmacogenomics, nutrigenomics, epigenetics, and systems biology
    Q Yan - Methods Mol. Biol, 2010 - Springer
     
    5. Carboxypeptidase A6 gene (CPA6) mutations in a recessive familial form of febrile seizures and temporal lobe epilepsy and in sporadic temporal lobe epilepsy
    A Salzmann, M Guipponi, PJ Lyons, LD Fricker - Human , 2011 - Wiley Online Library
     
    6. Crystal structure of a putative transcriptional regulator SCO0520 from Streptomyces coelicolorA3 (2) reveals an unusual dimer among TetR family proteins
    EV Filippova, M Chruszcz, M Cymborowski - Journal of structural and , 2011 - Springer
     
    7. Dipeptidyl Peptidases: Substrates and Therapeutic Targeting in Human Health and Disease
    CH Wilson, CA Abbott - 2011 - pubs.rsc.org
     
    8. Gentica e mecanismos moleculares na miocardiopatia hipertrfica: papel dos genes CSRP3 e TCAP
    LSD Silveira - 2011 - run.unl.pt
     
    9. Antibodies for ubiquitinated proteins
    G Xu, SR Jaffrey - US Patent App. 12/455,496, 2009 - Google Patents
     
    10. Transport of solutes across membranes
    E Buxbaum - Fundamentals of Protein Structure and Function, 2007 - Springer
     
    11. La multiplicit de transport de la P-glycoprotine: Etudes de modlisation comparative et de docking au sein de la famille des protines ABC
    A Bessadok - 2011 - hal.archives-ouvertes.fr
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch