| Title | Crystal structure of tyr/ser protein phosphatase from Vaccinia virus WR. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC7320 | | Molecular Characteristics | | Source | Vaccinia virus wr | | Alias Ids | TPS5115,AAO89378.1, 10254 | Molecular Weight | 19724.84 Da. | | Residues | 171 | Isoelectric Point | 9.21 | | Sequence | mdkkslykylllrstgdmhraksptimtrvtnnvylgnyknamdapssevkfkyvlnltmdkytlpnsn iniihiplvddtttdiskyfddvtaflskcdqrnepvlvhcaagvnrsgamilaylmsknkeslpmlyf lyvyhsmrdlrgafvenpsfkrqiiekyvidkn | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.57 | Rfree | 0.2183 | | Matthews' coefficent | 4.40 | Rfactor | 0.1913 | | Waters | 63 | Solvent Content | 72.06 |
| Ligand Information | | Ligands | | | Metals | | | |