.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pr1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Bacillus subtilis N-acetyltransferase YlbP protein in complex with Coenzyme-A. To be Published
    Site MCSG
    PDB Id 2pr1 Target Id APC1310
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4529,O34468, 1423 Molecular Weight 19038.84 Da.
    Residues 160 Isoelectric Point 5.96
    Sequence mtkverllinyktleefkkfkeygiqelsmleelqdniiendstspfygiyfgdklvarmslyqvngks npyfdnrqdylelwklevlpgyqnrgygralvefaksfkmpirtnprmksaefwnkmnfktvkydmard kgedpliwhpdmdremtpgesa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.20 Rfree 0.25462
    Matthews' coefficent 4.21 Rfactor 0.21548
    Waters 23 Solvent Content 70.80

    Ligand Information
    Ligands SUC (SUCROSE) x 2;SO4 (SULFATE) x 2;COA (COENZYME) x 2
    Metals CO (COBALT) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch