.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ppx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a HTH XRE-family like protein from Agrobacterium tumefaciens. TO BE PUBLISHED
    Site MCSG
    PDB Id 2ppx Target Id APC6027
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4980,NP_532418.1, 176299 Molecular Weight 10480.19 Da.
    Residues 95 Isoelectric Point 5.36
    Sequence mtdedseanaladpdnpplsaeqlasaprmprikiirralkltqeefsaryhiplgtlrdweqgrsepd qparaylkiiavdpegtaaalrkgat
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24382
    Matthews' coefficent 3.42 Rfactor 0.19607
    Waters 68 Solvent Content 64.05

    Ligand Information
    Ligands SO4 (SULFATE) x 6;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 2ppx
    1. Solution structure and biophysical properties of MqsA, a Zn-containing antitoxin from Escherichia coli
    E Papadopoulos, JF Collet, V Vukojevi_ - et Biophysica Acta (BBA , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch