.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ppq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the homoserine kinase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2ppq Target Id APC6151
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5021,NP_531475.1, 176299 Molecular Weight 36240.56 Da.
    Residues 322 Isoelectric Point 5.20
    Sequence mavytditedelrnfltqydvgsltsykgiaegvensnfllhttkdpliltlyekrvekndlpfflglm qhlaakglscplplprkdgellgelsgrpaalisflegmwlrkpeakhcrevgkalaamhlasegfeik rpnalsvdgwkvlwdkseeradevekglreeirpeidylaahwpkdlpagvihadlfqdnvfflgdels glidfyfacndllaydvsiclnawcfekdgaynvtkgkallegyqsvrplseaelealpllsrgsalrf fltrlydwlttpagalvvkkdpleylrklrfhrtianvaeyglage
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.23484
    Matthews' coefficent 2.84 Rfactor 0.18737
    Waters 223 Solvent Content 56.68

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2ppq
    1. Genomics, evolution, and crystal structure of a new family of bacterial spore kinases
    ED Scheeff, HL Axelrod, MD Miller - Proteins: Structure, , 2010 - Wiley Online Library
     
    2. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch